Lineage for d4in6m_ (4in6 M:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1958788Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1958789Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 1958790Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1958875Protein M (medium) subunit [81481] (3 species)
  7. 1958876Species Rhodobacter sphaeroides [TaxId:1063] [81479] (60 PDB entries)
    Uniprot P02953
  8. 1958893Domain d4in6m_: 4in6 M: [196968]
    Other proteins in same PDB: d4in6h1, d4in6h2, d4in6l_
    automated match to d2j8cm_
    complexed with bcl, bph, cdl, fe, ggd, gol, hto, lda, pc1, po4, spo, u10; mutant

Details for d4in6m_

PDB Entry: 4in6 (more details), 2.7 Å

PDB Description: (m)l214a mutant of the rhodobacter sphaeroides reaction center
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d4in6m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4in6m_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsaalfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

SCOPe Domain Coordinates for d4in6m_:

Click to download the PDB-style file with coordinates for d4in6m_.
(The format of our PDB-style files is described here.)

Timeline for d4in6m_: