| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() |
| Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
| Protein automated matches [190224] (5 species) not a true protein |
| Species Rhodobacter sphaeroides [TaxId:1063] [186985] (37 PDB entries) |
| Domain d4in6m_: 4in6 M: [196968] Other proteins in same PDB: d4in6l_ automated match to d2j8cm_ complexed with bcl, bph, cdl, fe, ggd, gol, hto, lda, pc1, po4, spo, u10; mutant |
PDB Entry: 4in6 (more details), 2.7 Å
SCOPe Domain Sequences for d4in6m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4in6m_ f.26.1.1 (M:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsaalfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg
Timeline for d4in6m_: