SCOPe 2.06: Domain d4in5m_: 4in5 M:

Lineage for d4in5m_ (4in5 M:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (60 PDB entries)
   Uniprot P02953

8. Domain d4in5m_: 4in5 M: [196967]
   Other proteins in same PDB: d4in5h1, d4in5h2, d4in5l_
   automated match to d2j8dm_
   complexed with bcl, bph, fe, gol, hto, k, lda, pc1, po4, spo, u10; mutant

Details for d4in5m_

PDB Entry: 4in5, 2.2 Å

PDB Description: (m)l214g mutant of the rhodobacter sphaeroides reaction center

PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d4in5m_:

Sequence; same for both SEQRES and ATOM records:

>d4in5m_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsaglfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d4in5m_:

• d4in5m_ first appeared in SCOPe 2.02
  
• d4in5m_ appears in SCOPe 2.05
  
• d4in5m_ appears in SCOPe 2.07
  
• d4in5m_ appears in the current release, SCOPe 2.08