Lineage for d4h8qa_ (4h8q A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766795Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 2766841Family b.1.28.0: automated matches [195425] (1 protein)
    not a true family
  6. 2766842Protein automated matches [195426] (7 species)
    not a true protein
  7. 2766843Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [195437] (5 PDB entries)
  8. 2766844Domain d4h8qa_: 4h8q A: [196958]
    automated match to d2o6pa1
    complexed with hem, zn; mutant

Details for d4h8qa_

PDB Entry: 4h8q (more details), 1.7 Å

PDB Description: Structure of the Q29T IsdX2-NEAT5 mutant in complex with heme
PDB Compounds: (A:) Iron Transport-associated domain protein

SCOPe Domain Sequences for d4h8qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h8qa_ b.1.28.0 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
lkdgqydiafkvlkdkteeismmntyvvsparltvkdgkkyiamtlknsewitkfqtekn
ggfadakvvsedkaantrvvefeandlfaklnakvkvdidsmnyhhfydvqiqfdptki

SCOPe Domain Coordinates for d4h8qa_:

Click to download the PDB-style file with coordinates for d4h8qa_.
(The format of our PDB-style files is described here.)

Timeline for d4h8qa_: