Lineage for d1qjda1 (1qjd A:1-102)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734319Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 2734353Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species)
  7. 2734354Species Shewanella frigidimarina [TaxId:56812] [48722] (16 PDB entries)
  8. 2734375Domain d1qjda1: 1qjd A:1-102 [19695]
    Other proteins in same PDB: d1qjda2, d1qjda3
    complexed with fad, gol, hec, na, teo

Details for d1qjda1

PDB Entry: 1qjd (more details), 1.8 Å

PDB Description: flavocytochrome c3 from shewanella frigidimarina
PDB Compounds: (A:) flavocytochrome c3

SCOPe Domain Sequences for d1qjda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qjda1 a.138.1.3 (A:1-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella frigidimarina [TaxId: 56812]}
adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
hfpgevactschsaheksmvycdschsfdfnmpyakkwlrde

SCOPe Domain Coordinates for d1qjda1:

Click to download the PDB-style file with coordinates for d1qjda1.
(The format of our PDB-style files is described here.)

Timeline for d1qjda1: