Lineage for d4ej8a_ (4ej8 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408655Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2408656Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2408657Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2408673Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2408719Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (58 PDB entries)
  8. 2408826Domain d4ej8a_: 4ej8 A: [196943]
    automated match to d2aoda_
    complexed with 1f1, dms, edo

Details for d4ej8a_

PDB Entry: 4ej8 (more details), 2.35 Å

PDB Description: apo hiv protease (pr) dimer in closed form with fragment 1f1 in the outside/top of flap
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d4ej8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ej8a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemnlpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

SCOPe Domain Coordinates for d4ej8a_:

Click to download the PDB-style file with coordinates for d4ej8a_.
(The format of our PDB-style files is described here.)

Timeline for d4ej8a_: