Lineage for d1e39a1 (1e39 A:1-102)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6906Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
  4. 6907Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
  5. 6954Family a.138.1.3: Di-heme elbow motif [48711] (5 proteins)
  6. 6975Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (2 species)
  7. 6976Species Shewanella frigidimarina [TaxId:56812] [48722] (3 PDB entries)
  8. 6977Domain d1e39a1: 1e39 A:1-102 [19694]
    Other proteins in same PDB: d1e39a2, d1e39a3

Details for d1e39a1

PDB Entry: 1e39 (more details), 1.8 Å

PDB Description: flavocytochrome c3 from shewanella frigidimarina histidine 365 mutated to alanine

SCOP Domain Sequences for d1e39a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e39a1 a.138.1.3 (A:1-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella frigidimarina}
adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
hfpgevactschsaheksmvycdschsfdfnmpyakkwlrde

SCOP Domain Coordinates for d1e39a1:

Click to download the PDB-style file with coordinates for d1e39a1.
(The format of our PDB-style files is described here.)

Timeline for d1e39a1: