Lineage for d4i03a_ (4i03 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570846Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2571256Protein automated matches [190182] (1 species)
    not a true protein
  7. 2571257Species Human (Homo sapiens) [TaxId:9606] [186920] (33 PDB entries)
  8. 2571271Domain d4i03a_: 4i03 A: [196935]
    automated match to d1os9a_
    complexed with ca, dms, edo, gol, l88, peg, pgo, zn

Details for d4i03a_

PDB Entry: 4i03 (more details), 1.7 Å

PDB Description: Human MMP12 in complex with a PEG-linked bifunctional L-glutamate motif inhibitor
PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d4i03a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i03a_ d.92.1.11 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavhaighsl
glghssdpkavmfptykyvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d4i03a_:

Click to download the PDB-style file with coordinates for d4i03a_.
(The format of our PDB-style files is described here.)

Timeline for d4i03a_: