Lineage for d4k3fa1 (4k3f A:22-260)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2164148Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196922] (6 PDB entries)
  8. 2164149Domain d4k3fa1: 4k3f A:22-260 [196923]
    Other proteins in same PDB: d4k3fa2
    automated match to d1xs5a_
    complexed with cl, gol, mse, so4

Details for d4k3fa1

PDB Entry: 4k3f (more details), 1.6 Å

PDB Description: crystal structure of a putative tonb-dependent receptor (pa5505) from pseudomonas aeruginosa pao1 at 1.60 a resolution
PDB Compounds: (A:) Probable TonB-dependent receptor

SCOPe Domain Sequences for d4k3fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k3fa1 c.94.1.0 (A:22-260) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
aesltvaatpvphaeilnvvkpllakegvdlkikeftdyvqpnvqvsekrldanffqhqp
yldefnkakgtdlvavtgvhieplgaysskykkldelpsgatvvipndatnggralllld
kagviklkdnksitatpkdivdnpknikireleaatlprvltqvdmalintnyaleakln
ptkdalaiegsdspyvnilvarpdnkdsdamqklakalhsaeikqfiqekykgavvpaf

SCOPe Domain Coordinates for d4k3fa1:

Click to download the PDB-style file with coordinates for d4k3fa1.
(The format of our PDB-style files is described here.)

Timeline for d4k3fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4k3fa2