SCOPe 2.06: Domain d4k3fa1: 4k3f A:22-260

Lineage for d4k3fa1 (4k3f A:22-260)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196922] (6 PDB entries)

8. Domain d4k3fa1: 4k3f A:22-260 [196923]
   Other proteins in same PDB: d4k3fa2
   automated match to d1xs5a_
   complexed with cl, gol, mse, so4

Details for d4k3fa1

PDB Entry: 4k3f, 1.6 Å

PDB Description: crystal structure of a putative tonb-dependent receptor (pa5505) from pseudomonas aeruginosa pao1 at 1.60 a resolution

PDB Compounds: (A:) Probable TonB-dependent receptor

SCOPe Domain Sequences for d4k3fa1:

Sequence; same for both SEQRES and ATOM records:

>d4k3fa1 c.94.1.0 (A:22-260) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
aesltvaatpvphaeilnvvkpllakegvdlkikeftdyvqpnvqvsekrldanffqhqp
yldefnkakgtdlvavtgvhieplgaysskykkldelpsgatvvipndatnggralllld
kagviklkdnksitatpkdivdnpknikireleaatlprvltqvdmalintnyaleakln
ptkdalaiegsdspyvnilvarpdnkdsdamqklakalhsaeikqfiqekykgavvpaf

Timeline for d4k3fa1:

• d4k3fa1 first appeared in SCOPe 2.02, called d4k3fa_
  
• d4k3fa1 was called d4k3fa_ in SCOPe 2.05
  
• d4k3fa1 appears in SCOPe 2.07
  
• d4k3fa1 appears in the current release, SCOPe 2.08