Lineage for d4jvpa1 (4jvp A:1-127)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2025070Species Vicugna pacos [TaxId:30538] [189756] (35 PDB entries)
  8. 2025083Domain d4jvpa1: 4jvp A:1-127 [196921]
    Other proteins in same PDB: d4jvpa2, d4jvpb2
    automated match to d1jtpb_
    complexed with so4

Details for d4jvpa1

PDB Entry: 4jvp (more details), 1.76 Å

PDB Description: Three dimensional structure of broadly neutralizing anti - Hepatitis C virus (HCV) glycoprotein E2 alpaca nanobody D03
PDB Compounds: (A:) Anti-HCV E2 alpaca nanobody D03

SCOPe Domain Sequences for d4jvpa1:

Sequence, based on SEQRES records: (download)

>d4jvpa1 b.1.1.1 (A:1-127) automated matches {Vicugna pacos [TaxId: 30538]}
evqlqasggglvqpggslrlsctasgftddyyaigwfrqapgkeregvscitnfdggtyy
adsvksrftmsrdnakntvylqmnslkpedtavyycaadkglcswlraggkvtfgswgqg
tqvtvss

Sequence, based on observed residues (ATOM records): (download)

>d4jvpa1 b.1.1.1 (A:1-127) automated matches {Vicugna pacos [TaxId: 30538]}
evqlqasggglvqpggslrlsctasgftddyyaigwfrqapgkeregvscitnfdggtyy
adsvksrftmsrdnkntvylqmnslkpedtavyycaadkglcswlraggkvtfgswgqgt
qvtvss

SCOPe Domain Coordinates for d4jvpa1:

Click to download the PDB-style file with coordinates for d4jvpa1.
(The format of our PDB-style files is described here.)

Timeline for d4jvpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jvpa2