Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Vicugna pacos [TaxId:30538] [189756] (35 PDB entries) |
Domain d4jvpa1: 4jvp A:1-127 [196921] Other proteins in same PDB: d4jvpa2, d4jvpb2 automated match to d1jtpb_ complexed with so4 |
PDB Entry: 4jvp (more details), 1.76 Å
SCOPe Domain Sequences for d4jvpa1:
Sequence, based on SEQRES records: (download)
>d4jvpa1 b.1.1.1 (A:1-127) automated matches {Vicugna pacos [TaxId: 30538]} evqlqasggglvqpggslrlsctasgftddyyaigwfrqapgkeregvscitnfdggtyy adsvksrftmsrdnakntvylqmnslkpedtavyycaadkglcswlraggkvtfgswgqg tqvtvss
>d4jvpa1 b.1.1.1 (A:1-127) automated matches {Vicugna pacos [TaxId: 30538]} evqlqasggglvqpggslrlsctasgftddyyaigwfrqapgkeregvscitnfdggtyy adsvksrftmsrdnkntvylqmnslkpedtavyycaadkglcswlraggkvtfgswgqgt qvtvss
Timeline for d4jvpa1: