SCOPe 2.02: Domain d4jvpa_: 4jvp A:

Lineage for d4jvpa_ (4jvp A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (15 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (5 PDB entries)

8. Domain d4jvpa_: 4jvp A: [196921]
   automated match to d1jtpb_
   complexed with so4

Details for d4jvpa_

PDB Entry: 4jvp, 1.76 Å

PDB Description: Three dimensional structure of broadly neutralizing anti - Hepatitis C virus (HCV) glycoprotein E2 alpaca nanobody D03

PDB Compounds: (A:) Anti-HCV E2 alpaca nanobody D03

SCOPe Domain Sequences for d4jvpa_:

Sequence, based on SEQRES records:

>d4jvpa_ b.1.1.1 (A:) automated matches {Vicugna pacos [TaxId: 30538]}
evqlqasggglvqpggslrlsctasgftddyyaigwfrqapgkeregvscitnfdggtyy
adsvksrftmsrdnakntvylqmnslkpedtavyycaadkglcswlraggkvtfgswgqg
tqvtvssaaale

Sequence, based on observed residues (ATOM records):

>d4jvpa_ b.1.1.1 (A:) automated matches {Vicugna pacos [TaxId: 30538]}
evqlqasggglvqpggslrlsctasgftddyyaigwfrqapgkeregvscitnfdggtyy
adsvksrftmsrdnkntvylqmnslkpedtavyycaadkglcswlraggkvtfgswgqgt
qvtvssaaale

Timeline for d4jvpa_:

• d4jvpa_ is new in SCOPe 2.02-stable
  
• d4jvpa_ appears in SCOPe 2.03
  
• d4jvpa_ appears in the current release, SCOPe 2.08, called d4jvpa1