SCOPe 2.08: Domain d4jvpa1: 4jvp A:1-127

Lineage for d4jvpa1 (4jvp A:1-127)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)

8. Domain d4jvpa1: 4jvp A:1-127 [196921]
   Other proteins in same PDB: d4jvpa2, d4jvpb2
   automated match to d1jtpb_
   complexed with so4

Details for d4jvpa1

PDB Entry: 4jvp, 1.76 Å

PDB Description: Three dimensional structure of broadly neutralizing anti - Hepatitis C virus (HCV) glycoprotein E2 alpaca nanobody D03

PDB Compounds: (A:) Anti-HCV E2 alpaca nanobody D03

SCOPe Domain Sequences for d4jvpa1:

Sequence, based on SEQRES records:

>d4jvpa1 b.1.1.1 (A:1-127) automated matches {Vicugna pacos [TaxId: 30538]}
evqlqasggglvqpggslrlsctasgftddyyaigwfrqapgkeregvscitnfdggtyy
adsvksrftmsrdnakntvylqmnslkpedtavyycaadkglcswlraggkvtfgswgqg
tqvtvss

Sequence, based on observed residues (ATOM records):

>d4jvpa1 b.1.1.1 (A:1-127) automated matches {Vicugna pacos [TaxId: 30538]}
evqlqasggglvqpggslrlsctasgftddyyaigwfrqapgkeregvscitnfdggtyy
adsvksrftmsrdnkntvylqmnslkpedtavyycaadkglcswlraggkvtfgswgqgt
qvtvss

Timeline for d4jvpa1:

• d4jvpa1 first appeared in SCOPe 2.02, called d4jvpa_
  
• d4jvpa1 appears in SCOPe 2.07