Lineage for d4jrrb_ (4jrr B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879937Species Legionella pneumophila [TaxId:272624] [196919] (2 PDB entries)
  8. 2879939Domain d4jrrb_: 4jrr B: [196920]
    Other proteins in same PDB: d4jrra2
    automated match to d3h93a_
    complexed with gol, so4

Details for d4jrrb_

PDB Entry: 4jrr (more details), 1.88 Å

PDB Description: crystal structure of disulfide bond oxidoreductase dsba1 from legionella pneumophila
PDB Compounds: (B:) Thiol:disulfide interchange protein dsbA

SCOPe Domain Sequences for d4jrrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jrrb_ c.47.1.0 (B:) automated matches {Legionella pneumophila [TaxId: 272624]}
fiegkdyqtvasaqlstnkdktpliteffsygcpwcykidaplndwatrmgkgahlervp
vvfkpnwdlyakayytaktlamsdkmnpilfkaiqedknplatkqsmvdffvahgvdrei
aksafensptidmrvnsgmslmahyqinavpafvvnnkyktdlqmagseerlfeilnylv
rksa

SCOPe Domain Coordinates for d4jrrb_:

Click to download the PDB-style file with coordinates for d4jrrb_.
(The format of our PDB-style files is described here.)

Timeline for d4jrrb_: