Lineage for d1fs7a_ (1fs7 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347197Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2347198Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2347351Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 2347352Protein Cytochrome c nitrite reductase [48718] (5 species)
  7. 2347370Species Wolinella succinogenes [TaxId:844] [48720] (3 PDB entries)
  8. 2347372Domain d1fs7a_: 1fs7 A: [19691]
    complexed with act, ca, hem, y1

Details for d1fs7a_

PDB Entry: 1fs7 (more details), 1.6 Å

PDB Description: cytochrome c nitrite reductase from wolinella succinogenes
PDB Compounds: (A:) cytochrome c nitrite reductase

SCOPe Domain Sequences for d1fs7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fs7a_ a.138.1.3 (A:) Cytochrome c nitrite reductase {Wolinella succinogenes [TaxId: 844]}
ktahsqgiegkamseewaryyprqfdswkktkesdnitdmlkekpalvvawagypfskdy
naprghyyalqdnintlrtgapvdgktgplpsacwtckspdvpriieqdgeleyftgkwa
kygdeivntigcynchddksaelkskvpyldrglsaagfktfaesthqekrslvcaqchv
eyyfkktewkddkgvdktamvvtlpwskgisteqmeayydeinfadwthgisktpmlkaq
hpdwelyktgihgqkgvscadchmpytqegavkysdhkvgnpldnmdkscmnchreseqk
lkdivkqkferkeflqdiafdnigkahletgkamelgatdaelkeirthirhaqwradma
iaghgsffhapeevlrllasgneeaqkariklvkvlakygaidyvapdfetkekaqklak
vdmeafiaeklkfkqtleqewkkqaiakgrlnpeslkgvdekssyydktkk

SCOPe Domain Coordinates for d1fs7a_:

Click to download the PDB-style file with coordinates for d1fs7a_.
(The format of our PDB-style files is described here.)

Timeline for d1fs7a_: