Lineage for d4iz7c_ (4iz7 C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2544153Protein MAP kinase Erk2 [56134] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 2544154Species Human (Homo sapiens) [TaxId:9606] [56135] (67 PDB entries)
  8. 2544156Domain d4iz7c_: 4iz7 C: [196907]
    automated match to d3sa0a_
    complexed with na

Details for d4iz7c_

PDB Entry: 4iz7 (more details), 1.8 Å

PDB Description: Structure of Non-Phosphorylated ERK2 bound to the PEA-15 Death Effector Domain
PDB Compounds: (C:) Mitogen-activated protein kinase 1

SCOPe Domain Sequences for d4iz7c_:

Sequence, based on SEQRES records: (download)

>d4iz7c_ d.144.1.7 (C:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]}
pemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqrtlr
eikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyfl
yqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvat
rwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqe
dlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalah
pyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgyr

Sequence, based on observed residues (ATOM records): (download)

>d4iz7c_ d.144.1.7 (C:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]}
pemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqrtlr
eikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyfl
yqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpeyvatrwyrapeim
lnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqedlnciinlk
arnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalahpyleqyydp
sdepiaeapfkfdmelddlpkeklkelifeetarfqpgyr

SCOPe Domain Coordinates for d4iz7c_:

Click to download the PDB-style file with coordinates for d4iz7c_.
(The format of our PDB-style files is described here.)

Timeline for d4iz7c_: