Lineage for d4ipnb_ (4ipn B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2084210Species Streptococcus pneumoniae [TaxId:170187] [196905] (2 PDB entries)
  8. 2084213Domain d4ipnb_: 4ipn B: [196906]
    automated match to d3qoma_
    complexed with 1ft

Details for d4ipnb_

PDB Entry: 4ipn (more details), 2.41 Å

PDB Description: The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae
PDB Compounds: (B:) 6-phospho-beta-glucosidase

SCOPe Domain Sequences for d4ipnb_:

Sequence, based on SEQRES records: (download)

>d4ipnb_ c.1.8.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
tifpddflwggavaanqvegaynedgkglsvqdvlpkgglgeatenptednlkligidfy
hkykedislfsemgfnvfrtsiawsrifpkgdeeepneaglkyydelfdelhahgieplv
tlshyetplylarkyhgwvdrrmihfyekfartvlerykdkvkywltfnevnsvlelpft
sggidipkenlskqelyqaihhelvasslvtkiareinsefkvgcmvlampaypmtpnpk
dvwatheyenlnylfsdvhvrgyypnyakryfkendiniefaaedaellknytvdflsfs
yymsvtqsalptqynsgegniigglvnpylessewgwqidpiglriilnryydryqiplf
ivenglgakdqlikdelnnltvqddyriqymkehllqvaealqdgveimgytswgcidcv
smstaqlskrygliyvdrnddgsgtlnrykkmsftwykeviesngeslf

Sequence, based on observed residues (ATOM records): (download)

>d4ipnb_ c.1.8.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
tifpddflwggavaanqvegaynedgkglsvqdvlpkgglgeatenptednlkligidfy
hkykedislfsemgfnvfrtsiawsrifpkgdeeepneaglkyydelfdelhahgieplv
tlshyetplylarkyhgwvdrrmihfyekfartvlerykdkvkywltfnevnsvlelpft
sggidipkenlskqelyqaihhelvasslvtkiareinsefkvgcmvlampaypmtpnpk
dvwatheyenlnylfsdvhvrgyypnyakryfkendiniefaaedaellknytvdflsfs
yymsvtqsalpglvnpylessewgwqidpiglriilnryydryqiplfivenglgakdql
ikdelnnltvqddyriqymkehllqvaealqdgveimgytswgcidcvsmstaqlskryg
liyvdrnddgsgtlnrykkmsftwykeviesngeslf

SCOPe Domain Coordinates for d4ipnb_:

Click to download the PDB-style file with coordinates for d4ipnb_.
(The format of our PDB-style files is described here.)

Timeline for d4ipnb_: