Lineage for d4hvka_ (4hvk A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132273Species Archaeoglobus fulgidus [TaxId:224325] [196899] (4 PDB entries)
  8. 2132274Domain d4hvka_: 4hvk A: [196900]
    automated match to d1p3wa_
    complexed with ca, cl, pg4, pmp

Details for d4hvka_

PDB Entry: 4hvk (more details), 1.43 Å

PDB Description: Crystal structure and functional studies of an unusual L-cysteine desulfurase from Archaeoglobus fulgidus.
PDB Compounds: (A:) Probable cysteine desulfurase 2

SCOPe Domain Sequences for d4hvka_:

Sequence, based on SEQRES records: (download)

>d4hvka_ c.67.1.0 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
ayfdytsakpvderileamlpymtesfgnpssvhsygfkareavqearekvaklvngggg
tvvftsgateannlaiigyamrnarkgkhilvsavehmsvinpakflqkqgfeveyipvg
kygevdvsfidqklrddtilvsvqhanneigtiqpveeisevlagkaalhidatasvgqi
evdvekigadmltissndiygpkgvgalwirkeaklqpvilgggqenglrsgsenvpsiv
gfgkaaeitamewreeaerlrrlrdriidnvlkieesylnghpekrlpnnvnvrfsyieg
esivlsldmagiqastgsacssktlqpshvlmacglkheeahgtllltlgryntdedvdr
llevlpgvierlrsmsp

Sequence, based on observed residues (ATOM records): (download)

>d4hvka_ c.67.1.0 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
ayfdytsakpvderileamlpymtesfgnpssvhsygfkareavqearekvaklvngggg
tvvftsgateannlaiigyamrnarkgkhilvsavehmsvinpakflqkqgfeveyipvg
kygevdvsfidqklrddtilvsvqhanneigtiqpveeisevlagkaalhidatasvgqi
evdvekigadmltissndiygpkgvgalwirkeaklqpvilgggqenglrsgsenvpsiv
gfgkaaeitamewreeaerlrrlrdriidnvlkieesylnghpekrlpnnvnvrfsyieg
esivlsldmagiqastgqpshvlmacglkheeahgtllltlgryntdedvdrllevlpgv
ierlrsmsp

SCOPe Domain Coordinates for d4hvka_:

Click to download the PDB-style file with coordinates for d4hvka_.
(The format of our PDB-style files is described here.)

Timeline for d4hvka_: