SCOP 1.69: Domain d1qdbc_: 1qdb C:

Lineage for d1qdbc_ (1qdb C:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (7 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein Cytochrome c nitrite reductase [48718] (4 species)

7. Species Sulfurospirillum deleyianum [TaxId:65553] [48719] (1 PDB entry)

8. Domain d1qdbc_: 1qdb C: [19690]

Details for d1qdbc_

PDB Entry: 1qdb, 1.9 Å

PDB Description: cytochrome c nitrite reductase

SCOP Domain Sequences for d1qdbc_:

Sequence; same for both SEQRES and ATOM records:

>d1qdbc_ a.138.1.3 (C:) Cytochrome c nitrite reductase {Sulfurospirillum deleyianum}
giagkekseewakyyprqfdswkktkeydsftdmlakdpalviawsgyafskdynsprgh
yyalqdnvnslrtgapvdaktgplptacwtckspdvprlieedgeleyftgkwakygsqi
vnvigcanchddktaelkvrvphlnrglqaaglktfeesthqdkrtlvcaqchveyyfkk
tewkdakgadktamvvtlpwangvgkdgnagvegmikyydeinfsdwthnisktpmlkaq
hpgfefwksgihgqkgvscadchmpytqegsvkysdhqvkenpldsmdqscmnchreses
klrgivhqkyerkeflnkvafdnigkahletgkaieagasdeelkevrklirhgqfkadm
aiaahgnyfhapeetlrllaagsddaqkarlllvkilakhgvmdyiapdfdtkdkaqkla
kvdiaalaaekmkfkqtleqewkkeakakgranpelykdvdtindgksswnkk

Timeline for d1qdbc_:

• d1qdbc_ first appeared (with stable ids) in SCOP 1.55
  
• d1qdbc_ appears in SCOP 1.67
  
• d1qdbc_ appears in SCOP 1.71
  
• d1qdbc_ appears in the current release, SCOPe 2.08