Lineage for d4fpie_ (4fpi E:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1204251Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1204576Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 1204577Protein automated matches [190081] (7 species)
    not a true protein
  7. 1204624Species Rhodococcus opacus [TaxId:37919] [196895] (3 PDB entries)
  8. 1204628Domain d4fpie_: 4fpi E: [196897]
    automated match to d1mlia_

Details for d4fpie_

PDB Entry: 4fpi (more details), 2.2 Å

PDB Description: Crystal Structure of 5-chloromuconolactone isomerase from Rhodococcus opacus 1CP
PDB Compounds: (E:) 5-chloromuconolactone dehalogenase

SCOPe Domain Sequences for d4fpie_:

Sequence, based on SEQRES records: (download)

>d4fpie_ d.58.4.0 (E:) automated matches {Rhodococcus opacus [TaxId: 37919]}
mlylvrmtvnlprnldsreeerlkasekarsrtlqeqgqwrylwrttgkygnisvfdvns
hdelheilwslpffpyltidveplshhparvgkd

Sequence, based on observed residues (ATOM records): (download)

>d4fpie_ d.58.4.0 (E:) automated matches {Rhodococcus opacus [TaxId: 37919]}
mlylvrmtvnlprnleerlkasekarsrtlqeqgqwrylwrttgkygnisvfdvnshdel
heilwslpffpyltidveplshhparvgkd

SCOPe Domain Coordinates for d4fpie_:

Click to download the PDB-style file with coordinates for d4fpie_.
(The format of our PDB-style files is described here.)

Timeline for d4fpie_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4fpic_