SCOPe 2.05: Domain d1qdbb_: 1qdb B:

Lineage for d1qdbb_ (1qdb B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein Cytochrome c nitrite reductase [48718] (5 species)

7. Species Sulfurospirillum deleyianum [TaxId:65553] [48719] (1 PDB entry)

8. Domain d1qdbb_: 1qdb B: [19689]
   complexed with ca, hem, so4

Details for d1qdbb_

PDB Entry: 1qdb, 1.9 Å

PDB Description: cytochrome c nitrite reductase

PDB Compounds: (B:) cytochrome c nitrite reductase

SCOPe Domain Sequences for d1qdbb_:

Sequence; same for both SEQRES and ATOM records:

>d1qdbb_ a.138.1.3 (B:) Cytochrome c nitrite reductase {Sulfurospirillum deleyianum [TaxId: 65553]}
giagkekseewakyyprqfdswkktkeydsftdmlakdpalviawsgyafskdynsprgh
yyalqdnvnslrtgapvdaktgplptacwtckspdvprlieedgeleyftgkwakygsqi
vnvigcanchddktaelkvrvphlnrglqaaglktfeesthqdkrtlvcaqchveyyfkk
tewkdakgadktamvvtlpwangvgkdgnagvegmikyydeinfsdwthnisktpmlkaq
hpgfefwksgihgqkgvscadchmpytqegsvkysdhqvkenpldsmdqscmnchreses
klrgivhqkyerkeflnkvafdnigkahletgkaieagasdeelkevrklirhgqfkadm
aiaahgnyfhapeetlrllaagsddaqkarlllvkilakhgvmdyiapdfdtkdkaqkla
kvdiaalaaekmkfkqtleqewkkeakakgranpelykdvdtindgksswnkk

Timeline for d1qdbb_:

• d1qdbb_ first appeared (with stable ids) in SCOP 1.55
  
• d1qdbb_ appears in SCOPe 2.04
  
• d1qdbb_ appears in SCOPe 2.06
  
• d1qdbb_ appears in the current release, SCOPe 2.08