Lineage for d4f5hb_ (4f5h B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1866062Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 1866405Protein automated matches [190317] (4 species)
    not a true protein
  7. 1866406Species Escherichia coli K-12 [TaxId:83333] [196886] (8 PDB entries)
  8. 1866410Domain d4f5hb_: 4f5h B: [196889]
    automated match to d1aama_

Details for d4f5hb_

PDB Entry: 4f5h (more details), 1.6 Å

PDB Description: Intercoversion of Substrate Specificity: E. coli Aspatate Aminotransferase to Tyrosine Aminotransferase: Chimera P3.
PDB Compounds: (B:) aspartate aminotransferase

SCOPe Domain Sequences for d4f5hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f5hb_ c.67.1.1 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
hhvgtfenitaapadpilgladlfraderpgkvdlgigvykdetgktpvmtsvkkaeqyl
lenettktylgldglpefgrctqellfgkgsalindkrartaqtpggsgalrvaadflak
ntsvkrvwvsnpswpnhkaifnsaglevreyayydaenhtldfdalinslneaqagdvvl
fhgcchnptgadptleqwqtlaqlsvekgwlplidfayqgfgrgleedaeglrafaamhk
elivassysknfglynervgactlvaadsetvdrafsqmkaairanyssppahgasvvat
ilsndalraiweqeltdmrqriqrlrqlfvntlqekganrdfsfiikqngmfsfsgltke
qvlrlreefgvyavasgrvnvagmtpdnmaplceaivavl

SCOPe Domain Coordinates for d4f5hb_:

Click to download the PDB-style file with coordinates for d4f5hb_.
(The format of our PDB-style files is described here.)

Timeline for d4f5hb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4f5ha_