Lineage for d4bioa_ (4bio A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2815433Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2815654Family b.82.2.6: Hypoxia-inducible factor HIF ihhibitor (FIH1) [82194] (1 protein)
  6. 2815655Protein Hypoxia-inducible factor HIF ihhibitor (FIH1) [82195] (1 species)
  7. 2815656Species Human (Homo sapiens) [TaxId:9606] [82196] (38 PDB entries)
  8. 2815682Domain d4bioa_: 4bio A: [196880]
    automated match to d2cgna_
    protein/DNA complex; complexed with 8xq, fe, gol, so4

Details for d4bioa_

PDB Entry: 4bio (more details), 2.45 Å

PDB Description: factor inhibiting hif-1 alpha in complex with 8-hydroxyquinoline-5- carboxylic acid
PDB Compounds: (A:) Hypoxia-inducible factor 1-alpha inhibitor

SCOPe Domain Sequences for d4bioa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bioa_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]}
sgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlv
ypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefve
klqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnlllig
megnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdye
rfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieypl
kahqkvaimrniekmlgealgnpqevgpllntmikgryn

SCOPe Domain Coordinates for d4bioa_:

Click to download the PDB-style file with coordinates for d4bioa_.
(The format of our PDB-style files is described here.)

Timeline for d4bioa_: