Lineage for d1qdba_ (1qdb A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 544896Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 544897Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 544980Family a.138.1.3: Di-heme elbow motif [48711] (7 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 544981Protein Cytochrome c nitrite reductase [48718] (4 species)
  7. 544990Species Sulfurospirillum deleyianum [TaxId:65553] [48719] (1 PDB entry)
  8. 544991Domain d1qdba_: 1qdb A: [19688]

Details for d1qdba_

PDB Entry: 1qdb (more details), 1.9 Å

PDB Description: cytochrome c nitrite reductase

SCOP Domain Sequences for d1qdba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qdba_ a.138.1.3 (A:) Cytochrome c nitrite reductase {Sulfurospirillum deleyianum}
giagkekseewakyyprqfdswkktkeydsftdmlakdpalviawsgyafskdynsprgh
yyalqdnvnslrtgapvdaktgplptacwtckspdvprlieedgeleyftgkwakygsqi
vnvigcanchddktaelkvrvphlnrglqaaglktfeesthqdkrtlvcaqchveyyfkk
tewkdakgadktamvvtlpwangvgkdgnagvegmikyydeinfsdwthnisktpmlkaq
hpgfefwksgihgqkgvscadchmpytqegsvkysdhqvkenpldsmdqscmnchreses
klrgivhqkyerkeflnkvafdnigkahletgkaieagasdeelkevrklirhgqfkadm
aiaahgnyfhapeetlrllaagsddaqkarlllvkilakhgvmdyiapdfdtkdkaqkla
kvdiaalaaekmkfkqtleqewkkeakakgranpelykdvdtindgksswnkk

SCOP Domain Coordinates for d1qdba_:

Click to download the PDB-style file with coordinates for d1qdba_.
(The format of our PDB-style files is described here.)

Timeline for d1qdba_: