SCOP 1.65: Domain d1qdba_: 1qdb A:

Lineage for d1qdba_ (1qdb A:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (6 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein Cytochrome c nitrite reductase [48718] (4 species)

7. Species Sulfurospirillum deleyianum [TaxId:65553] [48719] (1 PDB entry)

8. Domain d1qdba_: 1qdb A: [19688]

Details for d1qdba_

PDB Entry: 1qdb

PDB Description: cytochrome c nitrite reductase

SCOP Domain Sequences for d1qdba_:

Sequence; same for both SEQRES and ATOM records:

>d1qdba_ a.138.1.3 (A:) Cytochrome c nitrite reductase {Sulfurospirillum deleyianum}
giagkekseewakyyprqfdswkktkeydsftdmlakdpalviawsgyafskdynsprgh
yyalqdnvnslrtgapvdaktgplptacwtckspdvprlieedgeleyftgkwakygsqi
vnvigcanchddktaelkvrvphlnrglqaaglktfeesthqdkrtlvcaqchveyyfkk
tewkdakgadktamvvtlpwangvgkdgnagvegmikyydeinfsdwthnisktpmlkaq
hpgfefwksgihgqkgvscadchmpytqegsvkysdhqvkenpldsmdqscmnchreses
klrgivhqkyerkeflnkvafdnigkahletgkaieagasdeelkevrklirhgqfkadm
aiaahgnyfhapeetlrllaagsddaqkarlllvkilakhgvmdyiapdfdtkdkaqkla
kvdiaalaaekmkfkqtleqewkkeakakgranpelykdvdtindgksswnkk

Timeline for d1qdba_:

• d1qdba_ first appeared (with stable ids) in SCOP 1.55
  
• d1qdba_ appears in SCOP 1.63
  
• d1qdba_ appears in SCOP 1.67
  
• d1qdba_ appears in the current release, SCOPe 2.08