Lineage for d4aq6a_ (4aq6 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1138044Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1138045Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1138561Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 1138562Protein automated matches [190388] (7 species)
    not a true protein
  7. 1138577Species Pseudomonas putida [TaxId:160488] [196877] (1 PDB entry)
  8. 1138578Domain d4aq6a_: 4aq6 A: [196878]
    automated match to d1eyba_
    complexed with b3p, fe, omd

Details for d4aq6a_

PDB Entry: 4aq6 (more details), 1.98 Å

PDB Description: substrate bound homogentisate 1,2-dioxygenase
PDB Compounds: (A:) homogentisate 1,2-dioxygenase

SCOPe Domain Sequences for d4aq6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aq6a_ b.82.1.0 (A:) automated matches {Pseudomonas putida [TaxId: 160488]}
lhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselrrtwlyrir
psalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaanagaekpag
vsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiaviprgmkfrve
lldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvqlvqkflge
hwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsptsvhgman
mdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggaslhgvmsahg
pdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydscwatlpstf
npnrr

SCOPe Domain Coordinates for d4aq6a_:

Click to download the PDB-style file with coordinates for d4aq6a_.
(The format of our PDB-style files is described here.)

Timeline for d4aq6a_: