Lineage for d3w52a_ (3w52 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009738Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily)
    multihelical
  4. 2009739Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families) (S)
    duplication: all chain but the N-terminal helix forms two structural repeats
  5. 2009774Family a.124.1.0: automated matches [194368] (1 protein)
    not a true family
  6. 2009775Protein automated matches [194369] (3 species)
    not a true protein
  7. 2009781Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196872] (5 PDB entries)
  8. 2009783Domain d3w52a_: 3w52 A: [196873]
    automated match to d1ak0a_
    complexed with ade, so4, zn

Details for d3w52a_

PDB Entry: 3w52 (more details), 1.76 Å

PDB Description: zinc-dependent bifunctional nuclease
PDB Compounds: (A:) Endonuclease 2

SCOPe Domain Sequences for d3w52a_:

Sequence, based on SEQRES records: (download)

>d3w52a_ a.124.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
wgkegheiickiaqtrldetaakavkellpesaegdlsslclwadrvkfryhwssplhyi
ntpdacsyqynrdckdesgekgrcvagaiynyttqllsyktaassqsqynlteallfvsh
fmgdihqplhvsyasdkggntievhwytrkanlhhiwdsniietaeadlynsalegmvda
lkknittewadqvkrwetctkktacpdiyasegiqaacdwaykgvtegdtledeyfysrl
pivyqrlaqggvrlaatlnrifg

Sequence, based on observed residues (ATOM records): (download)

>d3w52a_ a.124.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
wgkegheiickiaqtrldetaakavkellpesaegdlsslclwadrvkfryhwssplhyi
ntpdacsyqynrdckdesgekgrcvagaiynyttqllsykqynlteallfvshfmgdihq
plhvsyasdkggntievhwytrkanlhhiwdsniietaeadlynsalegmvdalkknitt
ewadqvkrwetctkktacpdiyasegiqaacdwaykgvtegdtledeyfysrlpivyqrl
aqggvrlaatlnrifg

SCOPe Domain Coordinates for d3w52a_:

Click to download the PDB-style file with coordinates for d3w52a_.
(The format of our PDB-style files is described here.)

Timeline for d3w52a_: