Lineage for d3vrma_ (3vrm A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005811Species Pseudonocardia autotrophica [TaxId:2074] [189387] (8 PDB entries)
  8. 2005828Domain d3vrma_: 3vrm A: [196871]
    automated match to d3a51a_
    complexed with hem, vd3; mutant

Details for d3vrma_

PDB Entry: 3vrm (more details), 2.57 Å

PDB Description: Structure of cytochrome P450 Vdh mutant T107A with bound vitamin D3
PDB Compounds: (A:) Vitamin D(3) 25-hydroxylase

SCOPe Domain Sequences for d3vrma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vrma_ a.104.1.0 (A:) automated matches {Pseudonocardia autotrophica [TaxId: 2074]}
altttgteqhdlfsgtfwqnphpayaalraedpvrklalpdgpvwlltryadvreafvdp
rlskdwrhtlpedqradmpatptpmmilmdppdhtrlrklvgrsfavrrmnelepritei
adgllaglptdgpvdlmreyafqipvqvicellgvpaedrddfsawssvlvddspaddkn
aamgklhgylsdllerkrtepddallssllavsdedgdrlsqeelvamamllliaghett
vnligngvlallthpdqrkllaedpslissaveeflrfdspvsqapirftaedvtysgvt
ipagemvmlglaaanrdadwmpepdrlditrdasggvffghgihfclgaqlarlegrvai
grlfadrpelalavgldelvyrestlvrglsrmpvtmgprsa

SCOPe Domain Coordinates for d3vrma_:

Click to download the PDB-style file with coordinates for d3vrma_.
(The format of our PDB-style files is described here.)

Timeline for d3vrma_: