Lineage for d1ddcd_ (1ddc D:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6906Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
  4. 6907Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
  5. 6954Family a.138.1.3: Di-heme elbow motif [48711] (5 proteins)
  6. 6969Protein Dimeric di-heme split-soret cytochrome c [48716] (1 species)
  7. 6970Species Desulfovibrio desulfuricans, ATCC 27774 [TaxId:876] [48717] (1 PDB entry)
  8. 6974Domain d1ddcd_: 1ddc D: [19687]

Details for d1ddcd_

PDB Entry: 1ddc (more details), 2.5 Å

PDB Description: dimeric di-heme split-soret cytochrome c from desulfovibrio desulfuricans atcc 27774

SCOP Domain Sequences for d1ddcd_:

Sequence, based on SEQRES records: (download)

>d1ddcd_ a.138.1.3 (D:) Dimeric di-heme split-soret cytochrome c {Desulfovibrio desulfuricans, ATCC 27774}
rfdqvggafgwkphkldpkecaqvaydgywykgfgcgfgafysivglmgekygapynqfp
famleankggisdwgtiygalygaaatfslfwgrkevhpmvnelfrwyevtklpifnpgd
aaqgvkgdlpmsasdsvlchisvskwcyenkieatskqrseragrltadaafkaaeiint
kidqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatqnkfvnh

Sequence, based on observed residues (ATOM records): (download)

>d1ddcd_ a.138.1.3 (D:) Dimeric di-heme split-soret cytochrome c {Desulfovibrio desulfuricans, ATCC 27774}
rfdqvggafgwphkldpkecaqvaydgywykgfgcgfgafysivglmgekygapynqfpf
amleankggisdwgtiygalygaaatfslfwgrkevhpmvnelfrwyevtklpifnpgda
aqgvkgdlpmsasdsvlchisvskwcyenkieatkqrseragrltadaafkaaeiintki
dqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatqnkfvnh

SCOP Domain Coordinates for d1ddcd_:

Click to download the PDB-style file with coordinates for d1ddcd_.
(The format of our PDB-style files is described here.)

Timeline for d1ddcd_: