Lineage for d4iv3c_ (4iv3 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2821779Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2822070Protein automated matches [190854] (27 species)
    not a true protein
  7. 2822153Species Foot-and-mouth disease virus - type a [TaxId:12111] [196861] (4 PDB entries)
  8. 2822161Domain d4iv3c_: 4iv3 C: [196863]
    automated match to d1zba3_

Details for d4iv3c_

PDB Entry: 4iv3 (more details), 2.9 Å

PDB Description: crystal structure of recombinant foot-and-mouth-disease virus a22- h2093c empty capsid
PDB Compounds: (C:) capsid protein vp3

SCOPe Domain Sequences for d4iv3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iv3c_ b.121.4.1 (C:) automated matches {Foot-and-mouth disease virus - type a [TaxId: 12111]}
givpvacsdgygglvttdpktadpvygmvynpprtnypgrftnlldvaeacptflcfdeg
kpyvvtrtdeqrllakfdvslaakhmsntylsgiaqyyaqysgtinlhfmftgstdskar
ymvayvppgvetppdtpekaahcihaewdtglnskftfsipyvsaadyaytasdvaettn
vqgwvciyqithgkaeqdtlvvsvsagkdfelrlpidprsq

SCOPe Domain Coordinates for d4iv3c_:

Click to download the PDB-style file with coordinates for d4iv3c_.
(The format of our PDB-style files is described here.)

Timeline for d4iv3c_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4iv3a_