Lineage for d4ibra_ (4ibr A:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450062Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1450662Protein automated matches [190161] (19 species)
    not a true protein
  7. 1450707Species Escherichia coli [TaxId:562] [187306] (39 PDB entries)
  8. 1450769Domain d4ibra_: 4ibr A: [196859]
    automated match to d1jwva_
    complexed with ca, mes; mutant

Details for d4ibra_

PDB Entry: 4ibr (more details), 2.2 Å

PDB Description: crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying g238s/e104k mutations
PDB Compounds: (A:) TEM-94 ES-beta-lactamase

SCOPe Domain Sequences for d4ibra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ibra_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
hpetlvkvkdaedqlggrvgyieldlasgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlvkyspvtekhltdgmtvgelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpvamattlrklltgelltaasrq
qlidwmeadkvagpllrsalpagwfiadksgasergsrgiiaalgpdgkpsrivviymtg
sqatmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d4ibra_:

Click to download the PDB-style file with coordinates for d4ibra_.
(The format of our PDB-style files is described here.)

Timeline for d4ibra_: