SCOPe 2.03: Domain d4ibra_: 4ibr A:

Lineage for d4ibra_ (4ibr A:)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (19 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187306] (39 PDB entries)

8. Domain d4ibra_: 4ibr A: [196859]
   automated match to d1jwva_
   complexed with ca, mes; mutant

Details for d4ibra_

PDB Entry: 4ibr, 2.2 Å

PDB Description: crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying g238s/e104k mutations

PDB Compounds: (A:) TEM-94 ES-beta-lactamase

SCOPe Domain Sequences for d4ibra_:

Sequence; same for both SEQRES and ATOM records:

>d4ibra_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
hpetlvkvkdaedqlggrvgyieldlasgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlvkyspvtekhltdgmtvgelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpvamattlrklltgelltaasrq
qlidwmeadkvagpllrsalpagwfiadksgasergsrgiiaalgpdgkpsrivviymtg
sqatmdernrqiaeigaslikhw

Timeline for d4ibra_:

• d4ibra_ first appeared in SCOPe 2.02
  
• d4ibra_ appears in SCOPe 2.04
  
• d4ibra_ appears in the current release, SCOPe 2.08