Class a: All alpha proteins [46456] (284 folds) |
Fold a.12: Kix domain of CBP (creb binding protein) [47039] (1 superfamily) 3 helices; bundle, partly opened |
Superfamily a.12.1: Kix domain of CBP (creb binding protein) [47040] (1 family) |
Family a.12.1.1: Kix domain of CBP (creb binding protein) [47041] (2 proteins) |
Protein automated matches [196856] (1 species) not a true protein |
Species Mus musculus [TaxId:10090] [196857] (1 PDB entry) |
Domain d4i9oa_: 4i9o A: [196858] automated match to d1sb0a_ complexed with edo, ki1 |
PDB Entry: 4i9o (more details), 2 Å
SCOPe Domain Sequences for d4i9oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i9oa_ a.12.1.1 (A:) automated matches {Mus musculus [TaxId: 10090]} rkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesansrd eyyhllaekiykiqkece
Timeline for d4i9oa_: