Lineage for d4i9oa_ (4i9o A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697639Fold a.12: Kix domain of CBP (creb binding protein) [47039] (1 superfamily)
    3 helices; bundle, partly opened
  4. 2697640Superfamily a.12.1: Kix domain of CBP (creb binding protein) [47040] (1 family) (S)
    automatically mapped to Pfam PF02172
  5. 2697641Family a.12.1.1: Kix domain of CBP (creb binding protein) [47041] (1 protein)
  6. 2697642Protein Kix domain of CBP (creb binding protein) [47042] (1 species)
  7. 2697643Species Mouse (Mus musculus) [TaxId:10090] [47043] (13 PDB entries)
  8. 2697644Domain d4i9oa_: 4i9o A: [196858]
    automated match to d1sb0a_
    complexed with edo, ki1

Details for d4i9oa_

PDB Entry: 4i9o (more details), 2 Å

PDB Description: crystal structure of gackix l664c tethered to 1-10
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d4i9oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i9oa_ a.12.1.1 (A:) Kix domain of CBP (creb binding protein) {Mouse (Mus musculus) [TaxId: 10090]}
rkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesansrd
eyyhllaekiykiqkece

SCOPe Domain Coordinates for d4i9oa_:

Click to download the PDB-style file with coordinates for d4i9oa_.
(The format of our PDB-style files is described here.)

Timeline for d4i9oa_: