SCOPe 2.07: Domain d1bvba_: 1bvb A:

Lineage for d1bvba_ (1bvb A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein Cytochrome c554 [48714] (1 species)
   contains 1 complete motif

7. Species Nitrosomonas europaea [TaxId:915] [48715] (3 PDB entries)

8. Domain d1bvba_: 1bvb A: [19683]
   CASP3
   complexed with hem, po4

Details for d1bvba_

PDB Entry: 1bvb, 2.6 Å

PDB Description: heme-packing motifs revealed by the crystal structure of cytochrome c554 from nitrosomonas europaea

PDB Compounds: (A:) cytochrome c-554

SCOPe Domain Sequences for d1bvba_:

Sequence; same for both SEQRES and ATOM records:

>d1bvba_ a.138.1.3 (A:) Cytochrome c554 {Nitrosomonas europaea [TaxId: 915]}
adapfegrkkcsschkaqaqswkdtahakameslkpnvkkeakqkakldpakdytqdkdc
vgchvdgfgqkggytiespkpmltgvgceschgpgrnfrgdhrksgqafeksgkktprkd
lakkgqdfhfeercsachlnyegspwkgakapytpftpevdakytfkfdemvkevkamhe
hyklegvfegepkfkfhdefqasakpakkgk

Timeline for d1bvba_:

• d1bvba_ first appeared (with stable ids) in SCOP 1.55, called d1bvb__
  
• d1bvba_ appears in SCOPe 2.06
  
• d1bvba_ appears in the current release, SCOPe 2.08