Lineage for d1bvb__ (1bvb -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) 
Family a.138.1.3: Di-heme elbow motif [48711] (5 proteins) 
Protein Cytochrome c554 [48714] (1 species) Species Nitrosomonas europaea [TaxId:915] [48715] (3 PDB entries) 
Domain d1bvb__: 1bvb - [19683]
Details for d1bvb__
PDB Entry: 1bvb (more details), 2.6 Å
PDB Description: heme-packing motifs revealed by the crystal structure of cytochrome c554 from nitrosomonas europaea
SCOP Domain Sequences for d1bvb__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvb__ a.138.1.3 (-) Cytochrome c554 {Nitrosomonas europaea}
adapfegrkkcsschkaqaqswkdtahakameslkpnvkkeakqkakldpakdytqdkdc
vgchvdgfgqkggytiespkpmltgvgceschgpgrnfrgdhrksgqafeksgkktprkd
lakkgqdfhfeercsachlnyegspwkgakapytpftpevdakytfkfdemvkevkamhe
hyklegvfegepkfkfhdefqasakpakkgk
SCOP Domain Coordinates for d1bvb__:
Click to download the PDB-style file with coordinates for d1bvb__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bvb__:
- d1bvb__ appears in SCOP 1.57
- d1bvb__ appears in the current release, SCOPe 2.08, called d1bvba_
View in 3D