![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
![]() | Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
![]() | Protein Cytochrome c554 [48714] (1 species) contains 1 complete motif |
![]() | Species Nitrosomonas europaea [TaxId:915] [48715] (3 PDB entries) |
![]() | Domain d1bvba_: 1bvb A: [19683] CASP3 complexed with hem, po4 |
PDB Entry: 1bvb (more details), 2.6 Å
SCOPe Domain Sequences for d1bvba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvba_ a.138.1.3 (A:) Cytochrome c554 {Nitrosomonas europaea [TaxId: 915]} adapfegrkkcsschkaqaqswkdtahakameslkpnvkkeakqkakldpakdytqdkdc vgchvdgfgqkggytiespkpmltgvgceschgpgrnfrgdhrksgqafeksgkktprkd lakkgqdfhfeercsachlnyegspwkgakapytpftpevdakytfkfdemvkevkamhe hyklegvfegepkfkfhdefqasakpakkgk
Timeline for d1bvba_: