SCOPe 2.02: Domain d4e1ea_: 4e1e A:

Lineage for d4e1ea_ (4e1e A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.0: automated matches [196408] (1 protein)
   not a true family

6. Protein automated matches [196409] (3 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:5693] [196823] (2 PDB entries)

8. Domain d4e1ea_: 4e1e A: [196825]
   automated match to d2f89f_
   complexed with 0mw, ipe, mg, na

Details for d4e1ea_

PDB Entry: 4e1e, 2.65 Å

PDB Description: Crystal structure of Trypanosome cruzi farnesyl diphosphate synthase in complex with [2-(n-hexylamino)ethane-1,1-diyl]bisphosphonic acid and Mg2+

PDB Compounds: (A:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d4e1ea_:

Sequence; same for both SEQRES and ATOM records:

>d4e1ea_ a.128.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
asmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnvaeg
flavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpgvtt
qcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsnkld
pevaqpmttdfaeftpaiykrivkykttfytyllplvmglfvseaaasvemnlvervahl
igeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanygdkd
pakvavvkrlyseanlqadfaayeaevvreveslieqlkvksptfaesvavvwekthkrk
k

Timeline for d4e1ea_:

• d4e1ea_ is new in SCOPe 2.02-stable
  
• d4e1ea_ appears in SCOPe 2.03
  
• d4e1ea_ appears in the current release, SCOPe 2.08