![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
![]() | Superfamily a.128.1: Terpenoid synthases [48576] (6 families) ![]() duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
![]() | Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
![]() | Protein automated matches [196409] (46 species) not a true protein |
![]() | Species Trypanosoma cruzi [TaxId:5693] [196823] (68 PDB entries) |
![]() | Domain d4e1ea_: 4e1e A: [196825] automated match to d2f89f_ complexed with 0mw, ipe, mg, na |
PDB Entry: 4e1e (more details), 2.65 Å
SCOPe Domain Sequences for d4e1ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e1ea_ a.128.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]} asmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnvaeg flavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpgvtt qcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsnkld pevaqpmttdfaeftpaiykrivkykttfytyllplvmglfvseaaasvemnlvervahl igeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanygdkd pakvavvkrlyseanlqadfaayeaevvreveslieqlkvksptfaesvavvwekthkrk k
Timeline for d4e1ea_: