SCOPe 2.04: Domain d4bhxa_: 4bhx A:

Lineage for d4bhxa_ (4bhx A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189328] (2 PDB entries)

8. Domain d4bhxa_: 4bhx A: [196820]
   automated match to d3lhra_
   complexed with edo, peg, pge

Details for d4bhxa_

PDB Entry: 4bhx, 1.95 Å

PDB Description: crystal structure of the scan domain from human paternally expressed gene 3 protein

PDB Compounds: (A:) paternally-expressed gene 3 protein

SCOPe Domain Sequences for d4bhxa_:

Sequence; same for both SEQRES and ATOM records:

>d4bhxa_ a.28.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmtdseffhqrfrnliyvefvgprktliklrnlcldwlqpetrtkeeiiellvleqylti
ipeklkpwvrakkpenceklvtllenykem

Timeline for d4bhxa_:

• d4bhxa_ first appeared in SCOPe 2.02
  
• d4bhxa_ appears in SCOPe 2.03
  
• d4bhxa_ appears in SCOPe 2.05
  
• d4bhxa_ appears in the current release, SCOPe 2.08, called d4bhxa1