| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
| Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
| Protein Cytochrome c554 [48714] (1 species) contains 1 complete motif |
| Species Nitrosomonas europaea [TaxId:915] [48715] (3 PDB entries) |
| Domain d1ft6a_: 1ft6 A: [19682] complexed with dtn, hec, po4, so3 |
PDB Entry: 1ft6 (more details), 1.8 Å
SCOPe Domain Sequences for d1ft6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ft6a_ a.138.1.3 (A:) Cytochrome c554 {Nitrosomonas europaea [TaxId: 915]}
adapfegrkkcsschkaqaqswkdtahakameslkpnvkkeakqkakldpakdytqdkdc
vgchvdgfgqkggytiespkpmltgvgceschgpgrnfrgdhrksgqafeksgkktprkd
lakkgqdfhfeercsachlnyegspwkgakapytpftpevdakytfkfdemvkevkamhe
hyklegvfegepkfkfhdefqasakpak
Timeline for d1ft6a_: