Lineage for d1ft6a_ (1ft6 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734319Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 2734342Protein Cytochrome c554 [48714] (1 species)
    contains 1 complete motif
  7. 2734343Species Nitrosomonas europaea [TaxId:915] [48715] (3 PDB entries)
  8. 2734345Domain d1ft6a_: 1ft6 A: [19682]
    complexed with dtn, hec, po4, so3

Details for d1ft6a_

PDB Entry: 1ft6 (more details), 1.8 Å

PDB Description: reduced state of cytochrome c554 from nitrosomonas europaea
PDB Compounds: (A:) cytochrome c554

SCOPe Domain Sequences for d1ft6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ft6a_ a.138.1.3 (A:) Cytochrome c554 {Nitrosomonas europaea [TaxId: 915]}
adapfegrkkcsschkaqaqswkdtahakameslkpnvkkeakqkakldpakdytqdkdc
vgchvdgfgqkggytiespkpmltgvgceschgpgrnfrgdhrksgqafeksgkktprkd
lakkgqdfhfeercsachlnyegspwkgakapytpftpevdakytfkfdemvkevkamhe
hyklegvfegepkfkfhdefqasakpak

SCOPe Domain Coordinates for d1ft6a_:

Click to download the PDB-style file with coordinates for d1ft6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ft6a_: