| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (4 families) ![]() |
| Family b.1.6.0: automated matches [191376] (1 protein) not a true family |
| Protein automated matches [190458] (4 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [196808] (4 PDB entries) |
| Domain d1zvna1: 1zvn A:2-98 [196810] Other proteins in same PDB: d1zvna2, d1zvnb2 automated match to d2a4ca_ |
PDB Entry: 1zvn (more details), 2.16 Å
SCOPe Domain Sequences for d1zvna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zvna1 b.1.6.0 (A:2-98) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
wvwnqffvleeytgtdplyvgklhsdmdrgdgsikyilsgegagivftiddttgdihaiq
rldreersqytlraqaldrrtgrpmepesefiikiqd
Timeline for d1zvna1: