Lineage for d1zvna1 (1zvn A:2-98)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763414Superfamily b.1.6: Cadherin-like [49313] (4 families) (S)
  5. 2763525Family b.1.6.0: automated matches [191376] (1 protein)
    not a true family
  6. 2763526Protein automated matches [190458] (4 species)
    not a true protein
  7. 2763529Species Chicken (Gallus gallus) [TaxId:9031] [196808] (4 PDB entries)
  8. 2763531Domain d1zvna1: 1zvn A:2-98 [196810]
    Other proteins in same PDB: d1zvna2, d1zvnb2
    automated match to d2a4ca_

Details for d1zvna1

PDB Entry: 1zvn (more details), 2.16 Å

PDB Description: Crystal structure of chick MN-cadherin EC1
PDB Compounds: (A:) Cadherin 1

SCOPe Domain Sequences for d1zvna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zvna1 b.1.6.0 (A:2-98) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
wvwnqffvleeytgtdplyvgklhsdmdrgdgsikyilsgegagivftiddttgdihaiq
rldreersqytlraqaldrrtgrpmepesefiikiqd

SCOPe Domain Coordinates for d1zvna1:

Click to download the PDB-style file with coordinates for d1zvna1.
(The format of our PDB-style files is described here.)

Timeline for d1zvna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zvna2