Lineage for d1ft5a_ (1ft5 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734319Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 2734342Protein Cytochrome c554 [48714] (1 species)
    contains 1 complete motif
  7. 2734343Species Nitrosomonas europaea [TaxId:915] [48715] (3 PDB entries)
  8. 2734344Domain d1ft5a_: 1ft5 A: [19681]
    complexed with hem, po4

Details for d1ft5a_

PDB Entry: 1ft5 (more details), 1.6 Å

PDB Description: crystal structure of the oxidized state of cytochrome c554 from nitrosomonas europaea
PDB Compounds: (A:) cytochrome c554

SCOPe Domain Sequences for d1ft5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ft5a_ a.138.1.3 (A:) Cytochrome c554 {Nitrosomonas europaea [TaxId: 915]}
adapfegrkkcsschkaqaqswkdtahakameslkpnvkkeakqkakldpakdytqdkdc
vgchvdgfgqkggytiespkpmltgvgceschgpgrnfrgdhrksgqafeksgkktprkd
lakkgqdfhfeercsachlnyegspwkgakapytpftpevdakytfkfdemvkevkamhe
hyklegvfegepkfkfhdefqasakpakkgk

SCOPe Domain Coordinates for d1ft5a_:

Click to download the PDB-style file with coordinates for d1ft5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ft5a_: