Lineage for d1zvnb_ (1zvn B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1768942Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 1769032Family b.1.6.0: automated matches [191376] (1 protein)
    not a true family
  6. 1769033Protein automated matches [190458] (4 species)
    not a true protein
  7. 1769036Species Chicken (Gallus gallus) [TaxId:9031] [196808] (4 PDB entries)
  8. 1769039Domain d1zvnb_: 1zvn B: [196809]
    automated match to d2a4ca_

Details for d1zvnb_

PDB Entry: 1zvn (more details), 2.16 Å

PDB Description: Crystal structure of chick MN-cadherin EC1
PDB Compounds: (B:) Cadherin 1

SCOPe Domain Sequences for d1zvnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zvnb_ b.1.6.0 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
sgwvwnqffvleeytgtdplyvgklhsdmdrgdgsikyilsgegagivftiddttgdiha
iqrldreersqytlraqaldrrtgrpmepesefiikiqd

SCOPe Domain Coordinates for d1zvnb_:

Click to download the PDB-style file with coordinates for d1zvnb_.
(The format of our PDB-style files is described here.)

Timeline for d1zvnb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zvna_