SCOPe 2.06: Domain d3zvfa1: 3zvf A:1-183

Lineage for d3zvfa1 (3zvf A:1-183)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (19 species)
   not a true protein

7. Species Human enterovirus [TaxId:42789] [196804] (9 PDB entries)

8. Domain d3zvfa1: 3zvf A:1-183 [196807]
   Other proteins in same PDB: d3zvfa2
   automated match to d2vb0a_
   complexed with g85

Details for d3zvfa1

PDB Entry: 3zvf, 2.5 Å

PDB Description: 3c protease of enterovirus 68 complexed with michael receptor inhibitor 85

PDB Compounds: (A:) 3C protease

SCOPe Domain Sequences for d3zvfa1:

Sequence; same for both SEQRES and ATOM records:

>d3zvfa1 b.47.1.4 (A:1-183) automated matches {Human enterovirus [TaxId: 42789]}
gpgfdfaqaimkkntvvartekgeftmlgvhdrvavipthasvgetiyindvetkvldac
alrdltdtnleitivkldrnqkfrdirhflpryeddyndavlsvhtskfpnmyipvgqvt
nygflnlggtpthrilmynfptragqcggvvtttgkvigihvggngaqgfaamllhsyft
dtq

Timeline for d3zvfa1:

• d3zvfa1 first appeared in SCOPe 2.02, called d3zvfa_
  
• d3zvfa1 was called d3zvfa_ in SCOPe 2.05
  
• d3zvfa1 appears in SCOPe 2.07
  
• d3zvfa1 appears in the current release, SCOPe 2.08