Lineage for d3zv9a_ (3zv9 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1127558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1127559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1129501Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)
  6. 1129659Protein automated matches [190384] (12 species)
    not a true protein
  7. 1129700Species Human enterovirus [TaxId:42789] [196804] (3 PDB entries)
  8. 1129701Domain d3zv9a_: 3zv9 A: [196805]
    automated match to d2vb0a_
    complexed with g74

Details for d3zv9a_

PDB Entry: 3zv9 (more details), 2.05 Å

PDB Description: 3c protease of enterovirus 68 complexed with michael receptor inhibitor 74
PDB Compounds: (A:) 3C protease

SCOPe Domain Sequences for d3zv9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zv9a_ b.47.1.4 (A:) automated matches {Human enterovirus [TaxId: 42789]}
gpgfdfaqaimkkntvvartekgeftmlgvhdrvavipthasvgetiyindvetkvldac
alrdltdtnleitivkldrnqkfrdirhflpryeddyndavlsvhtskfpnmyipvgqvt
nygflnlggtpthrilmynfptragqcggvvtttgkvigihvggngaqgfaamllhsyft
dtqkhhhhh

SCOPe Domain Coordinates for d3zv9a_:

Click to download the PDB-style file with coordinates for d3zv9a_.
(The format of our PDB-style files is described here.)

Timeline for d3zv9a_: