SCOPe 2.02: Domain d2xiwb_: 2xiw B:

Lineage for d2xiwb_ (2xiw B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.1: "Histone-like" proteins from archaea [54161] (2 proteins)

6. Protein automated matches [190114] (1 species)
   not a true protein

7. Species Sulfolobus acidocaldarius [TaxId:2285] [186837] (10 PDB entries)

8. Domain d2xiwb_: 2xiw B: [196802]
   automated match to d1xyia_
   complexed with cl, so4

Details for d2xiwb_

PDB Entry: 2xiw, 1.5 Å

PDB Description: Crystal structure of the Sac7d-derived IgG1-binder C3-C24S

PDB Compounds: (B:) DNA-binding protein 7d

SCOPe Domain Sequences for d2xiwb_:

Sequence; same for both SEQRES and ATOM records:

>d2xiwb_ b.34.13.1 (B:) automated matches {Sulfolobus acidocaldarius [TaxId: 2285]}
vkvkfllngeekevdtskirdvsrqgknvkflyndngkygagnvdekdapkelldmlara
erekkln

Timeline for d2xiwb_:

• d2xiwb_ is new in SCOPe 2.02-stable
  
• d2xiwb_ appears in SCOPe 2.03
  
• d2xiwb_ appears in the current release, SCOPe 2.08, called d2xiwb1