Lineage for d2xiwb1 (2xiw B:2-66)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785033Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2785034Family b.34.13.1: Histone-like proteins from archaea [54161] (2 proteins)
  6. 2785055Protein automated matches [190114] (2 species)
    not a true protein
  7. 2785056Species Sulfolobus acidocaldarius [TaxId:2285] [186837] (12 PDB entries)
  8. 2785058Domain d2xiwb1: 2xiw B:2-66 [196802]
    Other proteins in same PDB: d2xiwb2
    automated match to d1xyia_
    complexed with cl, so4

Details for d2xiwb1

PDB Entry: 2xiw (more details), 1.5 Å

PDB Description: Crystal structure of the Sac7d-derived IgG1-binder C3-C24S
PDB Compounds: (B:) DNA-binding protein 7d

SCOPe Domain Sequences for d2xiwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xiwb1 b.34.13.1 (B:2-66) automated matches {Sulfolobus acidocaldarius [TaxId: 2285]}
vkvkfllngeekevdtskirdvsrqgknvkflyndngkygagnvdekdapkelldmlara
erekk

SCOPe Domain Coordinates for d2xiwb1:

Click to download the PDB-style file with coordinates for d2xiwb1.
(The format of our PDB-style files is described here.)

Timeline for d2xiwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xiwb2
View in 3D
Domains from other chains:
(mouse over for more information)
d2xiwa_