Class a: All alpha proteins [46456] (290 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
Protein Hydroxylamine oxidoreductase, HAO [48712] (1 species) contains 3 complete motifs |
Species Nitrosomonas europaea [TaxId:915] [48713] (1 PDB entry) |
Domain d1fgjb_: 1fgj B: [19680] complexed with hec, hem |
PDB Entry: 1fgj (more details), 2.8 Å
SCOPe Domain Sequences for d1fgjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fgjb_ a.138.1.3 (B:) Hydroxylamine oxidoreductase, HAO {Nitrosomonas europaea [TaxId: 915]} distvpdetydalkldrgkatpketyealvkrykdpahgagkgtmgdywepiaisiymdp ntfykppvspkevaerkdcvechsdetpvwvrawkrsthanldkirnlksddplyykkgk leevennlrsmgklgeketlkevgcidchvdvnkkdkadhtkdirmptadtcgtchlref aereserdtmvwpngqwpagrpshaldytaniettvwatmpqrevaegctmchtnqnkcd nchtrhefsaaesrkpeacatchsgvdhnnweaytmskhgklaemnrdkwnwevrlkdaf skggqnaptcaachmeyegeythnitrktrwanypfvpgiaenitsdwsearldswvltc tqchserfarsyldlmdkgtleglakyqeanaivhkmyedgtltgqktnrpnppepekpg fgiftqlfwskgnnpaslelkvlemgennlakmhvglahvnpggwtytegwgpmnrayve iqdeytkmqelsalqarvn
Timeline for d1fgjb_: