Lineage for d1fgjb_ (1fgj B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734319Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 2734395Protein Hydroxylamine oxidoreductase, HAO [48712] (1 species)
    contains 3 complete motifs
  7. 2734396Species Nitrosomonas europaea [TaxId:915] [48713] (1 PDB entry)
  8. 2734398Domain d1fgjb_: 1fgj B: [19680]
    complexed with hec, hem

Details for d1fgjb_

PDB Entry: 1fgj (more details), 2.8 Å

PDB Description: x-ray structure of hydroxylamine oxidoreductase
PDB Compounds: (B:) hydroxylamine oxidoreductase

SCOPe Domain Sequences for d1fgjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fgjb_ a.138.1.3 (B:) Hydroxylamine oxidoreductase, HAO {Nitrosomonas europaea [TaxId: 915]}
distvpdetydalkldrgkatpketyealvkrykdpahgagkgtmgdywepiaisiymdp
ntfykppvspkevaerkdcvechsdetpvwvrawkrsthanldkirnlksddplyykkgk
leevennlrsmgklgeketlkevgcidchvdvnkkdkadhtkdirmptadtcgtchlref
aereserdtmvwpngqwpagrpshaldytaniettvwatmpqrevaegctmchtnqnkcd
nchtrhefsaaesrkpeacatchsgvdhnnweaytmskhgklaemnrdkwnwevrlkdaf
skggqnaptcaachmeyegeythnitrktrwanypfvpgiaenitsdwsearldswvltc
tqchserfarsyldlmdkgtleglakyqeanaivhkmyedgtltgqktnrpnppepekpg
fgiftqlfwskgnnpaslelkvlemgennlakmhvglahvnpggwtytegwgpmnrayve
iqdeytkmqelsalqarvn

SCOPe Domain Coordinates for d1fgjb_:

Click to download the PDB-style file with coordinates for d1fgjb_.
(The format of our PDB-style files is described here.)

Timeline for d1fgjb_: