Lineage for d4it8a_ (4it8 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301126Protein Myoglobin [46469] (10 species)
  7. 2301271Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (301 PDB entries)
    Uniprot P02185
  8. 2301453Domain d4it8a_: 4it8 A: [196797]
    automated match to d2eb8a_
    complexed with hem; mutant

Details for d4it8a_

PDB Entry: 4it8 (more details), 1.5 Å

PDB Description: a sperm whale myoglobin mutant l29h mb with two distal histidines
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d4it8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4it8a_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdihirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d4it8a_:

Click to download the PDB-style file with coordinates for d4it8a_.
(The format of our PDB-style files is described here.)

Timeline for d4it8a_: