Lineage for d4ioja_ (4ioj A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111791Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 protein domains)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2112083Protein automated matches [190304] (11 species)
    not a true protein
  7. 2112115Species Moorella thermoacetica [TaxId:264732] [196795] (3 PDB entries)
  8. 2112116Domain d4ioja_: 4ioj A: [196796]
    automated match to d3rboa_
    complexed with so4, toe

Details for d4ioja_

PDB Entry: 4ioj (more details), 2.2 Å

PDB Description: N10-formyltetrahydrofolate synthetase from Moorella thermoacetica with sulfate
PDB Compounds: (A:) Formate--tetrahydrofolate ligase

SCOPe Domain Sequences for d4ioja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ioja_ c.37.1.10 (A:) automated matches {Moorella thermoacetica [TaxId: 264732]}
kvpsdieiaqaakmkpvmelarglgiqedevelygkykakisldvyrrlkdkpdgklilv
taitptpagegktttsvgltdalarlgkrvmvclrepslgpsfgikggaagggyaqvvpm
edinlhftgdihavtyahnllaamvdnhlqqgnvlnidprtitwrrvidlndralrnivi
glggkangvpretgfdisvasevmaclclasdlmdlkerfsrivvgytydgkpvtagdle
aqgsmallmkdaikpnlvqtlentpafihggpfaniahgcnsiiatktalkladyvvtea
gfgadlgaekfydvkcryagfkpdatvivatvralkmhggvpksdlatenlealregfan
lekhienigkfgvpavvainafptdteaelnllyelcakagaevalsevwakggegglel
arkvlqtlesrpsnfhvlynldlsikdkiakiateiygadgvnytaeadkaiqryeslgy
gnlpvvmaktqysfsddmtklgrprnftitvrevrlsagagfivpitgaimtmpglpkrp
aacnididadgvitglf

SCOPe Domain Coordinates for d4ioja_:

Click to download the PDB-style file with coordinates for d4ioja_.
(The format of our PDB-style files is described here.)

Timeline for d4ioja_: