| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
Superfamily a.23.5: Hemolysin expression modulating protein HHA [68989] (2 families) ![]() automatically mapped to Pfam PF05321 |
| Family a.23.5.1: Hemolysin expression modulating protein HHA [68990] (2 proteins) |
| Protein automated matches [196791] (2 species) not a true protein |
| Species Salmonella enterica [TaxId:990282] [196792] (1 PDB entry) |
| Domain d4icgc_: 4icg C: [196794] automated match to d1jw2a_ protein/DNA complex |
PDB Entry: 4icg (more details), 2.92 Å
SCOPe Domain Sequences for d4icgc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4icgc_ a.23.5.1 (C:) automated matches {Salmonella enterica [TaxId: 990282]}
ltktdylmrlrrcqtidtlervieknkyelsdnelavfysaadhrlaeltmnklydkips
svwkfir
Timeline for d4icgc_: