Lineage for d4icgc_ (4icg C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699273Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 2699409Superfamily a.23.5: Hemolysin expression modulating protein HHA [68989] (2 families) (S)
    automatically mapped to Pfam PF05321
  5. 2699410Family a.23.5.1: Hemolysin expression modulating protein HHA [68990] (2 proteins)
  6. 2699416Protein automated matches [196791] (2 species)
    not a true protein
  7. 2699417Species Salmonella enterica [TaxId:990282] [196792] (1 PDB entry)
  8. 2699418Domain d4icgc_: 4icg C: [196794]
    automated match to d1jw2a_
    protein/DNA complex

Details for d4icgc_

PDB Entry: 4icg (more details), 2.92 Å

PDB Description: n-terminal dimerization domain of h-ns in complex with hha (salmonella typhimurium)
PDB Compounds: (C:) Hemolysin expression modulating protein (Involved in environmental regulation of virulence factors)

SCOPe Domain Sequences for d4icgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4icgc_ a.23.5.1 (C:) automated matches {Salmonella enterica [TaxId: 990282]}
ltktdylmrlrrcqtidtlervieknkyelsdnelavfysaadhrlaeltmnklydkips
svwkfir

SCOPe Domain Coordinates for d4icgc_:

Click to download the PDB-style file with coordinates for d4icgc_.
(The format of our PDB-style files is described here.)

Timeline for d4icgc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4icgd_